DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc12a

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_002663098.1 Gene:zdhhc12a / 100332332 ZFINID:ZDB-GENE-081104-40 Length:270 Species:Danio rerio


Alignment Length:193 Identity:45/193 - (23%)
Similarity:74/193 - (38%) Gaps:52/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FHRHFQLHRIKVMG-LLHP--FCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTV 87
            |..:..|.|.:..| ||.|  |.::.||.:        |.|....:.||..:             
Zfish    28 FLHNTDLRRCQERGDLLQPLVFSSVLLLSV--------LLYFTVSLMDPGFV------------- 71

  Fly    88 INILGNWWLGCMTNTSVDSL------VLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICI 146
                       ::::..::.      .||...|....:.....|..|..|.|.|:.||..|..|:
Zfish    72 -----------LSDSQTETASGDGDEELEAMIPQEQNSIKQRRCGYCFLLQPMRARHCKWCKRCV 125

  Fly   147 LKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGS---GQALVYNGILN------W-TNKAFLVV 199
            .:.||||.:..:|:|..|.|:||.:|. :.|.:   |....::|.::      | |...||:|
Zfish   126 RRFDHHCPWIDNCVGELNHRWFLLYLC-VQFTAVCWGLQSAWSGFISAPSWQQWFTQNVFLLV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 28/87 (32%)
zdhhc12aXP_002663098.1 DHHC 104..221 CDD:396215 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.