DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc23a

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_021327278.1 Gene:zdhhc23a / 100150190 ZFINID:ZDB-GENE-060526-38 Length:434 Species:Danio rerio


Alignment Length:281 Identity:69/281 - (24%)
Similarity:113/281 - (40%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HFQLHRIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQ--------ITDPHGIWHKLCWFMGIY 85
            ::..||.|...|.....|:|.|..:..||:.|   ::|:        :|...|:         :.
Zfish   116 YYMTHRRKRRTLFFLSLALFSLAYMYYLFLTE---IVPRGDVTHLQVVTATTGM---------ML 168

  Fly    86 TVINIL-----------GNWWLGC--------MTNTSVDSLVLERQYPVAGEAHLWHYCSTCQKL 131
            |:|:::           .:..||.        .||.::|:.:......:.||..:...|..||.:
Zfish   169 TLISLVRTKQGPGFVKSQSLALGINSSLATNRSTNLTLDTDLRNGVSHLKGEKDVKKKCPVCQLV 233

  Fly   132 VPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFL--AFLFHLSFGSGQALVYNGILNWTNK 194
            .|||:.||.:|..|:|:.||||.:..||:|..|.|.|:  ..||.|:...|.:||...|.     
Zfish   234 RPPRAGHCRICGACVLRMDHHCVWINSCVGQANHRQFILTLLLFLLTSFYGISLVLRSIC----- 293

  Fly   195 AFLVVDPLLLMFQDTTQDADFKWKYTIANLFK---LNLFLFGVPLFMFVFQMIMVYRNSTCYKML 256
                  |...:|...........:|:.|..|.   .::.:.|..|.:|:.|:|.|..|.|     
Zfish   294 ------PKQSLFTAMLYCPGVYNQYSTALCFTCVWYSVIITGGLLHLFILQIINVSCNVT----- 347

  Fly   257 DRSYDVGWRRNFDMVLGKRRF 277
            :|...:..|..    .|:|||
Zfish   348 EREAQIALRNK----TGRRRF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 40/132 (30%)
zdhhc23aXP_021327278.1 zf-DHHC 224..352 CDD:307600 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.