DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc20b

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_005162815.2 Gene:zdhhc20b / 100001188 ZFINID:ZDB-GENE-091117-30 Length:409 Species:Danio rerio


Alignment Length:215 Identity:51/215 - (23%)
Similarity:89/215 - (41%) Gaps:63/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGI 188
            ||..||.:.|.|..|||.|::|:||.||||.:..:|:|..|.::|:.||.:       :|||   
Zfish   156 YCDRCQVIKPDRCHHCSACDMCVLKMDHHCPWVNNCVGFSNYKFFILFLTY-------SLVY--- 210

  Fly   189 LNWTNKAFLVVDPLLLMF-----------QDTTQDADFKWKYTIANLFKLNLFLFGVP------- 235
                  ...:...:|..|           .:....:|....:...::    ||||.|.       
Zfish   211 ------CLFIAASVLQYFIKFWTLCRRKSAENCPKSDLPESHAKFHV----LFLFFVAAMFCISI 265

  Fly   236 LFMFVFQMIMVYRNSTCYKML---------DRS-YDVGWRRNFDMVLG-KRRFW---IFFSP--- 283
            |.:|.:.:.:|.:|.:..:..         |:: :.:|:.:|...|.| ::::|   :|.|.   
Zfish   266 LSLFTYHLWLVGKNRSTIEAFRAPVFRNGPDKNGFSLGFSKNIAQVFGDEKKYWLLPVFTSQGDG 330

  Fly   284 --------TISSPLPTDGTQ 295
                    ||....||:..|
Zfish   331 LSFPTRLVTIDPEQPTECLQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 38/144 (26%)
zdhhc20bXP_005162815.2 zf-DHHC 44..342 CDD:327686 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.