DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4956 and zdhhc22

DIOPT Version :9

Sequence 1:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:305 Identity:71/305 - (23%)
Similarity:112/305 - (36%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FQLHRIKVMGLLHP--FCA--IFLLCLIGLLFVYELCYVLPQITDPHGIWH--KLCWFMGIYTVI 88
            |::.::|::..:.|  |.|  :....|..|||...:........:|..:.|  ...:.||     
Zfish     3 FKMGKLKLLNTIAPAYFYAATVVTFALHFLLFTPTIFQSSDVTINPAMLAHISIFLFLMG----- 62

  Fly    89 NILGNWWLGCMTNTSVDSLVLERQYPVAG-------EAHLW----HYCSTCQKLVPPRSWHCSLC 142
            |.|||:   .||..:......|...||..       :||..    |:|..|:|:           
Zfish    63 NALGNY---IMTIRNPSESANETVIPVCSPDCPDRIDAHYLLNGRHFCKVCKKV----------- 113

  Fly   143 NICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQ 207
               ||||||||.|..:|||::|.|||:.|..:.|.....:||. |:      |:|.::       
Zfish   114 ---ILKRDHHCFFTGNCIGNRNMRYFIMFSIYTSSSCLYSLVI-GV------AYLTIE------- 161

  Fly   208 DTTQDADFKWKYTIANLFKLNLFLF------GVPLFMFVF-----------------QMIMVYRN 249
               ....|:...|...|..|:...|      |:..|:.:.                 |:::|.|.
Zfish   162 ---YSISFENPLTFLTLLPLSTGYFFLGLISGLQFFLVIMLYIWLGIGLVSVGFCCQQLLLVARG 223

  Fly   250 STCYKMLDRSYDV---GWRRNFDMVLGKRRFWIFFSPTISSPLPT 291
            .|..::.......   .||.|...|.|..  |:.   .:..|:||
Zfish   224 QTWCELQKGQLSECRGTWRANLTDVFGSH--WVL---GLFVPVPT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 37/150 (25%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.