DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and PFA3

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_014073.1 Gene:PFA3 / 855390 SGDID:S000005270 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:58/214 - (27%)
Similarity:85/214 - (39%) Gaps:54/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGH 142
            ||:...: ||..|.|         :..|:.|...:..|..||..|:.|||:.||||.:...|.|.
Yeast    89 YMSKRCL-TLKHDGR---------FRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGF 143

  Fly   143 NNQRFFFWFTFYLTL--GLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFETIA 205
            .||:||..|..|.||  .||..:..:.:....|.|:| :...:.|:|:         |.....:|
Yeast   144 RNQKFFIQFLMYTTLYAFLVLIYTCYELGTWFNSGSF-NRELIDFHLL---------GVALLAVA 198

  Fly   206 FLLNISASYMPAFMLAYQ-------------------MQILSQ----NSTYYNIFDCTYDLGFRK 247
            ..:::.|  ...|.: ||                   ::||:.    |....||||....:.   
Yeast   199 VFISVLA--FTCFSI-YQVCKNQTTIEVHGMRRYRRDLEILNDSYGTNEHLENIFDLGSSMA--- 257

  Fly   248 NCQTIMGQRGL-WTFISPL 265
            |.|.|||...| |  |.|:
Yeast   258 NWQDIMGTSWLEW--ILPI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/155 (25%)
PFA3NP_014073.1 COG5273 1..304 CDD:227598 58/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.