DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and AKR1

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_010550.1 Gene:AKR1 / 851857 SGDID:S000002672 Length:764 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:54/262 - (20%)
Similarity:98/262 - (37%) Gaps:78/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VHPLSIV-FVLCSTAFFFSL------QMFYIAPKVFGDIAYKLYWILVTFIT-HNILGNML---- 75
            ||.:::: ..|.|..||.:|      ..|.:.|:.|.|..|....:||..:: ..:.|.::    
Yeast   377 VHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQLVIMDP 441

  Fly    76 ACY----------MTSSSVNTLSK-DSRCPNPEDEPLWHYC-ESCKKLRSP-RSWHCVLCNTCIL 127
            .|.          .|.|::..:.| |::          ::| |:.  :|.| ||....|.|..:.
Yeast   442 GCLPEETDHENVRQTISNLLEIGKFDTK----------NFCIETW--IRKPLRSKFSPLNNAVVA 494

  Fly   128 RRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFIL------------QNGGNF-MS 179
            |.||:|.:....:|..|.:.|.:|...:..|:.| |...|:...            :||..| :.
Yeast   495 RFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFT-FLALCLEYFDELEDAHEDTSQKNGKCFILG 558

  Fly   180 LSSVIFNLITRTFFQNYTGNTFETIAFLLNI----------SASYMPAFMLAYQMQILSQNSTYY 234
            .|.:...||            ::...||:.:          |..::.||.:...|     .:|.:
Yeast   559 ASDLCSGLI------------YDRFVFLILLWALLQSIWVASLIFVQAFQICKGM-----TNTEF 606

  Fly   235 NI 236
            |:
Yeast   607 NV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 33/155 (21%)
AKR1NP_010550.1 ANK repeat 75..101 CDD:293786
ANKYR 78..270 CDD:223738
ANK repeat 103..140 CDD:293786
ANK repeat 142..173 CDD:293786
ANK repeat 213..244 CDD:293786
ANK repeat 246..271 CDD:293786
COG5273 363..725 CDD:227598 54/262 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.