DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ERF2

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_013347.1 Gene:ERF2 / 850947 SGDID:S000004236 Length:359 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:63/232 - (27%)
Similarity:86/232 - (37%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCN 123
            |:.|:|..||                :::|||...         .||.||:..|.|||.||..||
Yeast   154 YYNLITLPTH----------------SSISKDITI---------KYCPSCRIWRPPRSSHCSTCN 193

  Fly   124 TCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNL- 187
            .|::..|||||:...|||..|.|||..|.....|..|.......:.|.:..|........|..| 
Yeast   194 VCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLTNCAIHIARESGGPRDCPVAILLLC 258

  Fly   188 ----------ITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYD 242
                      |..|:.....||...|..||..|.:...|.|....:.:         ||    |:
Yeast   259 YAGLTLWYPAILFTYHIFMAGNQQTTREFLKGIGSKKNPVFHRVVKEE---------NI----YN 310

  Fly   243 LG-FRKNCQTIMGQRGLWTFISPLLKSPLPHDGAHWQ 278
            .| |.||...:|.:....:|:|    :..||:...|:
Yeast   311 KGSFLKNMGHLMLEPRGPSFVS----ARKPHEAGDWR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 42/141 (30%)
ERF2NP_013347.1 COG5273 47..359 CDD:227598 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.