DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:243 Identity:61/243 - (25%)
Similarity:96/243 - (39%) Gaps:73/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LCSTAFFFSLQMFYIAPKV-----FGDIAYKLYWILVTFITHNILGNML----ACYMTSSSVNTL 87
            |||.|          :|::     .|::...|.::|:      :||::|    ...|....||..
Human    82 LCSPA----------SPELRQWEEQGELLLPLTFLLL------VLGSLLLYLAVSLMDPGYVNVQ 130

  Fly    88 SKDSRCPNPEDE-------------PLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTC 139
                  |.|::|             || ..|..|..|:..|:.||..|..|:.|.||||.:...|
Human   131 ------PQPQEELKEEQTAMVPPAIPL-RRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENC 188

  Fly   140 IGHNNQRFFFWFTFYLTL-------GLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYT 197
            :|..|...   |..||.|       ||..:::....|  |..|.::..|.::|    .||.   .
Human   189 VGERNHPL---FVVYLALQLVVLLWGLYLAWSGLRFF--QPWGQWLRSSGLLF----ATFL---L 241

  Fly   198 GNTFETIAFLLNISASYMPA-------FMLAYQMQILSQNSTYYNIFD 238
            .:.|..:|.||.:|..|:.|       |:.::::..|.|..:  |.||
Human   242 LSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPS--NPFD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/144 (27%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.