DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and AT3G18620

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:277 Identity:66/277 - (23%)
Similarity:108/277 - (38%) Gaps:75/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNT 86
            |.|.::...:..||...|.|..|..|.|...          :.:.||..:||        .::|.
plant   100 IFHSVTTATLAISTLSTFILVAFKCAGKPTN----------ILYGTHPGVGN--------GALNN 146

  Fly    87 LSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWF 151
                           :.:|..|.|.:|||:.||..|..|:|..||||.|.|.|:|..|.::|  .
plant   147 ---------------YTFCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIGNCVGAGNHKYF--I 194

  Fly   152 TFYLTLGLVTSF-ATFCMFIL-------QNG------------GNFMSLSSVIFNLITRTFFQNY 196
            .|.::..:.||: |..|::.|       :.|            ||.:|:..|:.| |..|:..|.
plant   195 AFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASDVAHVAHGNSISILRVVKN-ICLTYIANA 258

  Fly   197 TGNTFETIA----FLLNISASYMPAFMLAYQMQILSQNSTYYNIFDC--TYDLGFRKNCQTIMGQ 255
            ...:..::.    |:.::|.:...:.:|..|:..:.:..||.:....  |.:.| .|:|      
plant   259 VFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQGTEEDG-EKSC------ 316

  Fly   256 RGLWTFISPLLKSPLPH 272
            |.|.||..      .||
plant   317 RNLLTFFG------CPH 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 41/154 (27%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 41/153 (27%)
DHHC 149..298 CDD:396215 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D863846at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.