DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment CG17195 and AT2G40990

Sequence 1:	NP_651427.2	Gene:	CG17195 / 43113	FlyBaseID:	FBgn0039369	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_181632.5	Gene:	AT2G40990 / 818699	AraportID:	AT2G40990	Length:	411	Species:	Arabidopsis thaliana

Alignment Length:	30	Identity:	9/30 - (30%)
Similarity:	15/30 - (50%)	Gaps:	12/30 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   259 QHSSVILFLN------------KKDLLEEK 276
            |:||::|.::            |.|||:.|
plant    36 QNSSLLLSISYNILPETSWIQIKWDLLDPK 65

Gene	Sequence	Domain	Region	External ID
CG17195	NP_651427.2	DHHC	103..234	CDD:396215
AT2G40990	NP_181632.5	DHHC	160..282	CDD:396215
Blue background indicates that the domain is not in the aligned region.