DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:239 Identity:55/239 - (23%)
Similarity:91/239 - (38%) Gaps:63/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNT-LSKDSRCPNPEDEPLWH----- 103
            |.|..|.|.:          ||.|.|: :::|..:..:..|. |.||...|.|..:...|     
Mouse    73 YAANIVMGGV----------FIFHLIV-HLIAITIDPADTNVRLKKDYTQPVPAFDRSKHTHVIQ 126

  Fly   104 --YCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATF 166
              ||..|:...|.::.||..||.|:...||||.:...|:|..|..||||......:|::......
Mouse   127 NQYCHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNNCVGRRNYWFFFWSVASAAVGILGVMIIL 191

  Fly   167 CMFILQNGGN---------------------FMSL------SSVIFNLITRTFFQNYTGNTFETI 204
            |...:|...|                     |:||      :.::.::              ..:
Mouse   192 CYICIQYFVNPDELRTDPLYKEIISENTWLLFLSLWPVPVKTPIVLSI--------------AVM 242

  Fly   205 AFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKN 248
            |.||.|::..|...:|.:.:.::::|   .:.||......|:||
Mouse   243 ALLLAIASFVMLGHLLIFHLYLITKN---MSTFDYLMKTRFKKN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/164 (21%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 36/170 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4573
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.