DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:275 Identity:71/275 - (25%)
Similarity:102/275 - (37%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQMFYI-----APKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEP 100
            |::.|:     .|...|.:|..|...|..:...|:|||::....:..|:..:....|.....   
Mouse    31 LELAYVMVLGPGPPPLGPLARALQLALAAYQLLNLLGNVVLFLRSDPSIRGVMLAGRGLGQG--- 92

  Fly   101 LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165
             |.||..|:....|||.||..|..|||||||||...|.|:|.:|.|.|                 
Mouse    93 -WAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPF----------------- 139

  Fly   166 FCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAYQMQILSQN 230
            .|: :|.:.|..:.: ||:.........|.:  :...|:|.||      :|..||......|:|.
Mouse   140 LCL-LLHSAGVLLHI-SVLLGPALSALLQAH--SALYTVALLL------LPWLMLLTGKVSLAQF 194

  Fly   231 STYYNIFDCT--------------------------------YDLGFRKNCQTIMGQRGLWTFIS 263
            :..:.:..|.                                ||||...|.|..:|.|....:..
Mouse   195 ALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGHHCYDLGTCHNLQAALGPRWALVWFW 259

  Fly   264 PLLKSPLPHDGAHWQ 278
            |.|.||||.||..:|
Mouse   260 PFLASPLPGDGISFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/130 (30%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4731
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm42544
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.