DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:310 Identity:69/310 - (22%)
Similarity:111/310 - (35%) Gaps:112/310 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IAPKVFGDIAYK----LYWILVTFIT-------------------HNILGNMLACYMTS------ 81
            :||...|.:..:    ||||.|.||:                   .|| |..:.|.|..      
Mouse     1 MAPSGSGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENI-GEQVVCLMAYHLLFAM 64

  Fly    82 ------SSVNTL----SKD-----------SRCPNPE-----------DEPLW--------HYCE 106
                  .::.||    ||:           .|.|..|           |.|::        .||:
Mouse    65 FVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCD 129

  Fly   107 SCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFIL 171
            .|:.::..|..||.:|:.|||:.||||.:...|:|.:|.:||..|..|..|        :|:||.
Mouse   130 RCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL--------YCLFIA 186

  Fly   172 QNGGNFMSLSSVIFNLITRTFFQNYTGNTFET-----IAFLLNISASYMPAF--MLAYQMQILSQ 229
            .....:              |.:.:|....:|     |.||...:|.:..:.  :..|...::|:
Mouse   187 ATDLQY--------------FIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSK 237

  Fly   230 NSTYYNIF----------DCTYDLGFRKNCQTIMG-QRGLWTFISPLLKS 268
            |.:....|          ...:.|||.||.:.:.| ::..|  :.|:..|
Mouse   238 NKSTLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYW--LLPVFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/137 (26%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 36/142 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.