DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:287 Identity:61/287 - (21%)
Similarity:108/287 - (37%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWIL-----------VTFITHNILGNML 75
            |:.|:.|:..:.:.|...|           |.      |:|           :..:.:.::.::|
Mouse    31 ILDPIGILCAMAAWALVLS-----------GG------WVLFRDLLIPSNNMLYIVANGVVFHLL 78

  Fly    76 ACYMTSSSVNTLSKD-SRCP--NPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTG 137
            |....:|.:.|:..| ...|  ||.......||..|.......:.||.:|..||.:.||||.:..
Mouse    79 ASLALASHLRTMLTDPGSVPLGNPPGPDTVSYCTDCHSAIPRTACHCTVCQRCIRKNDHHCPWIN 143

  Fly   138 TCIGHNNQRFFFWFTFYLTLG-----LVTSFATFCMFIL--QNGGNFMSLSSVIFNLITRTFFQN 195
            .|||.:||::|..||.|:.|.     |:......|.::.  .:..:.:||.:.|..|:       
Mouse   144 NCIGEDNQKYFLLFTMYIGLTSTHVLLLLGIPVLCSYMRGEWDSSSTVSLPAPILFLL------- 201

  Fly   196 YTGNTFETIAFLLNISASYMPAFMLAYQMQIL-SQNSTYYNIFDCTYDLGFRKNC---QTIMGQR 256
                       |:.|........||..||.:: |..:|...::..|:..|....|   :.:.|..
Mouse   202 -----------LVAIMGFLFAVVMLCSQMCVIYSDKTTTELLYQNTHSGGRWSKCANMKAVCGSH 255

  Fly   257 GLWTFISPLLKSPLPHDGAHWQMKQSH 283
            ....::||.      |...|:::.:.|
Mouse   256 VSLAWLSPF------HSPEHYKVSEHH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 36/138 (26%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.