DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:332 Identity:73/332 - (21%)
Similarity:113/332 - (34%) Gaps:108/332 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNRFCHYFANRYPKNFVRIVHPLSI--VFVLCST-AFFFSLQMFYIAPKVFGDIAYKLYWILVTF 65
            :.|.||:             .|:..  |..:||| |...|:..::......|.:.:.:.......
Human    16 LKRLCHW-------------GPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVM 67

  Fly    66 ITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPL-W-----------HYCESCKKLRSPRSWH 118
            |.:|....|..                  .|...|| |           .||:.|:..::|||.|
Human    68 ILYNYFNAMFV------------------GPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHH 114

  Fly   119 CVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFI-------LQNGGN 176
            |..||.|:::.||||.:...|.|:.|...|..|.....||.:.:...|.|.:       |..|.|
Human   115 CRKCNRCVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWN 179

  Fly   177 FMS----------LSSVIFNLITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAY--QMQILSQ 229
            .:.          |..|.|.|.           .|.|..|.|.::.....|..:.:  ||:|:.:
Human   180 TVKIDMSAARRDPLPIVPFGLA-----------AFATTLFALGLALGTTIAVGMLFFIQMKIILR 233

  Fly   230 NST---------------YY---NIFDCTYDLGFR-KNCQTIMGQRGLWTFISPLLKSPLPH-DG 274
            |.|               ||   .:|...||:|.| :|.:.:.    .|        |.:|. ||
Human   234 NKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVF----TW--------SGVPEGDG 286

  Fly   275 AHWQMKQ 281
            ..|.:::
Human   287 LEWPVRE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 41/164 (25%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 41/156 (26%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.