DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc5a

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_005160301.1 Gene:zdhhc5a / 571795 ZFINID:ZDB-GENE-090312-92 Length:760 Species:Danio rerio


Alignment Length:304 Identity:69/304 - (22%)
Similarity:109/304 - (35%) Gaps:94/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKNFVRIVHPLS--IVFVLCSTAFFFSL------QMFYIAPKVFGDIAYKLYWILVTFITHNILG 72
            |..:|    |:|  ..|::.||..||..      :.|.:|..::..:.:  .::|..|       
Zfish    28 PSRYV----PVSAATAFLVGSTTLFFCFTCPWLSEQFSVAVPIYNGVMF--MFVLANF------- 79

  Fly    73 NMLACYMTSSSVNTLSKDSRCPNPEDE---PLW------------HYCESCKKLRSPRSWHCVLC 122
                |..|........:.....:.||:   ||:            .:|.:|:..|.||..||.:|
Zfish    80 ----CMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVC 140

  Fly   123 NTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVI--- 184
            :.|:...||||.:...|||..|.|:||.|...||..::..|....:|||.:......:.|.:   
Zfish   141 DNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLFILYHTQQLDRVHSAVTMA 205

  Fly   185 -----------------FNLIT----RTFFQNYTG------NTFETIAFLLNISASYMPAFMLAY 222
                             |:::.    ||..:..||      |.| |...|.|:|           
Zfish   206 VMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPF-TNGCLRNVS----------- 258

  Fly   223 QMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFISPLL 266
            .:...||...|         ||.::..||:..|.   .|:.|.|
Zfish   259 HVLCSSQAPRY---------LGRKRKAQTVSVQP---PFLRPQL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 41/160 (26%)
zdhhc5aXP_005160301.1 zf-DHHC 116..241 CDD:279823 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.