DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc4

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:308 Identity:68/308 - (22%)
Similarity:109/308 - (35%) Gaps:95/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FVRIVHPL------SIVFVLCSTAF-----FFSLQMFYIAPKVFGDIAYKLYWILVTFITHNI-- 70
            |.|||.|.      ||.:......|     ||......:...|:|:..|:::...:...:.::  
Zfish    39 FTRIVSPCIPQWLQSICYRTMHRLFHQRNNFFLYLHLLLEVVVYGEFTYEVFGFCLDMGSSSLSL 103

  Fly    71 --------LGNMLACYMTSSSVNTLSKDSRCPNPE----DEPLWHY---CESCKKLRSPRSWHCV 120
                    |.:.|.....|....||:|.:...:.:    ||.|:..   |.:|:.::..||.||.
Zfish   104 CVPYILLALKSCLFYLCCSRDPGTLTKSNLSAHLKIYQYDEKLFQQGMKCSTCQLIKPARSKHCR 168

  Fly   121 LCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSS-VI 184
            :||.|:.|.||||::...|||..|.|:|.   .||            :.:....||...|:: ::
Zfish   169 VCNRCVQRFDHHCVWVNNCIGAQNTRYFM---LYL------------LSVCAMAGNIAVLTTDML 218

  Fly   185 FNLITRT--------------------FFQNYTGNTFETIAFLLNISASYMPAFMLA------YQ 223
            ...:.||                    |...:...||..|.|:|.......  |:||      :.
Zfish   219 LQTVLRTGLLHAHYIDEQGIQQPAGPLFIIQHLFLTFPRIVFMLGFLVFVF--FLLAGYCLFHFY 281

  Fly   224 MQILSQNS-----------------------TYYNIFDCTYDLGFRKN 248
            :.:::|.|                       |.||.|...|..|..||
Zfish   282 LVLVNQTSNEWFKAKGHNCQHCHPYSGHNCRTSYNPFRGFYHRGILKN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/183 (21%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 38/160 (24%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.