DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC7

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:244 Identity:56/244 - (22%)
Similarity:83/244 - (34%) Gaps:87/244 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IAPKVF------GDIAYKLYWILVTF-------------------ITHNILGNMLACYMTSSSVN 85
            :|.:|:      |.|...:.|:||.:                   :.:.::.|.||....||.:.
Human    35 VADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLR 99

  Fly    86 TL----SKDSRC-PN-------------------------------PEDEPLWHYCES------- 107
            |:    .|.|.| |:                               |:......|.||       
Human   100 TMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGE 164

  Fly   108 ----CKK---LRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165
                |.|   ::..|:.||.:|..||.:.||||.:...|:|..|||||..||.|:.|..|.:. .
Human   165 VIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHAL-I 228

  Fly   166 FC--MFILQNGGNFMSLSS---------VIFNLITRTFFQNYTGNTFET 203
            .|  .||....|.:...|.         :||..:....|..:|...|.|
Human   229 LCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGT 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/126 (30%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 35/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.