DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc2

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_021336686.1 Gene:zdhhc2 / 541365 ZFINID:ZDB-GENE-050320-58 Length:374 Species:Danio rerio


Alignment Length:312 Identity:64/312 - (20%)
Similarity:117/312 - (37%) Gaps:92/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNML--ACYMT--S 81
            |:::.:.::|:....|:.:...:..:..:...::..|..::|:    :::|..|.  :.:.|  |
Zfish    13 RVLYWIPVLFISLIVAWSYYAYVVQLCIETIENMGEKTVYLLI----YHLLFLMFVWSYWQTIYS 73

  Fly    82 SSVNTLS--------------KDSRCPNPE-------DEPLW--------HYCESCKKLRSPRSW 117
            ..:|.|.              :|.|....|       |.|::        .||:.|..|:..|..
Zfish    74 KPMNPLKEFHLSHVDKELLEREDRRESQQEILRRIAKDLPIYTRTMSGAIRYCDRCLLLKPDRCH 138

  Fly   118 HCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSS 182
            ||..|:.|||:.||||.:...|:|..|.:||..|..|..|        :|:|:......:     
Zfish   139 HCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAYSLL--------YCLFVTATDMQY----- 190

  Fly   183 VIFNLITRTFFQNYT--GNTFETIAFLLN---------------ISASYMP---AFMLAYQMQIL 227
                     |.|.:|  |.|.:.:...||               .:||...   ||:.||...::
Zfish   191 ---------FIQFWTVDGKTHDRLIQYLNGLPDTQAKFHIMFLFFAASTFSVSLAFLFAYHCWLV 246

  Fly   228 SQNSTYYNIFDCT----------YDLGFRKNCQTIMG-QRGLWTFISPLLKS 268
            .:|.:....|...          :.||..||.:.:.| ::..|  :.|:..|
Zfish   247 CKNRSTLEAFRAPAFQHGTDKNGFSLGAYKNFRQVFGDEKKYW--LLPIFSS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/150 (26%)
zdhhc2XP_021336686.1 zf-DHHC 11..305 CDD:327686 64/312 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.