DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC3

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_016862050.1 Gene:ZDHHC3 / 51304 HGNCID:18470 Length:378 Species:Homo sapiens


Alignment Length:218 Identity:49/218 - (22%)
Similarity:80/218 - (36%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WILVTF-------------------ITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEP----- 100
            |.||.:                   |.:.|:.|:||....:|....:..|     |...|     
Human    52 WFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTD-----PGAVPKGNAT 111

  Fly   101 -------------LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFT 152
                         :.:.|..|..::..|:.||.:|..||.:.||||.:...|:|.|||::|..||
Human   112 KEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFT 176

  Fly   153 FYLTLGLVTSFATFCMFILQNGGNFMSLSSVI---FNLITRTFFQNYTGNTFETIAFLLNISASY 214
            .|:.|                    :||.::|   |:.: ..|.:::|       .:.||.....
Human   177 MYIAL--------------------ISLHALIMVGFHFL-HCFEEDWT-------TYGLNREEMA 213

  Fly   215 MPAFMLAYQMQILSQNSTYYNIF 237
            .....|..:||.|:.:||..:.|
Human   214 ETGISLHEKMQPLNFSSTECSSF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 36/133 (27%)
ZDHHC3XP_016862050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.