DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC2

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_011542846.1 Gene:ZDHHC2 / 51201 HGNCID:18469 Length:412 Species:Homo sapiens


Alignment Length:319 Identity:71/319 - (22%)
Similarity:119/319 - (37%) Gaps:96/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRIVHP-----------LSIVFVLCST-AFFFSLQMFYIAPKVFGDIAYKLYWILVTF--ITHNI 70
            :|:.||           .|:....|.| ...|..:|..|.|::...::.....:..||  :...|
Human    39 LRLRHPAVHSVHGKHWRTSLQIEFCQTLGKEFYPEMAVIVPEILKALSCVPDGLSSTFCNVCLVI 103

  Fly    71 LGNMLACYMTSSS-----------------VNTLSKD--SRCPNPE-----------DEPLW--- 102
            |.|.|  |:|:.|                 ::...||  .|.|..|           |.|::   
Human   104 LENYL--YITNESFKRNGATGFEHETIKFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRT 166

  Fly   103 -----HYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTS 162
                 .||:.|:.::..|..||.:|:.|||:.||||.:...|:|.:|.:||..|..|..|     
Human   167 MSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL----- 226

  Fly   163 FATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFET-----IAFLLNISASYMPAF--ML 220
               :|:||......:              |.:.:|....:|     |.||...:|.:..:.  :.
Human   227 ---YCLFIAATDLQY--------------FIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLF 274

  Fly   221 AYQMQILSQNSTYYNIFDCT----------YDLGFRKNCQTIMG-QRGLWTFISPLLKS 268
            .|...::|:|.:....|...          :.|||.||.:.:.| ::..|  :.|:..|
Human   275 GYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYW--LLPIFSS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/137 (26%)
ZDHHC2XP_011542846.1 zf-DHHC 172..293 CDD:279823 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.