DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:262 Identity:58/262 - (22%)
Similarity:97/262 - (37%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFSLQMFYIAPK------VFGDI--AYKLYWILVT-FITHNILGNML---ACY 78
            |::..:|.:...||:.:..|:|.:      ||..:  .:.:..:|.| |....::...|   |.:
Human    40 LTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF 104

  Fly    79 --MTSSSVNTLSKDSRCPNPEDEPL--------WHYCESCKKLRSPRSWHCVLCNTCILRRDHHC 133
              |...:.|......:.|.|..:..        ..||.:||..|.||:.||.:|:.|:.|.||||
Human   105 IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHC 169

  Fly   134 IFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTG 198
            .:.|.|:|..|.|:|:.|...|:|..:..||                    ||::       |..
Human   170 PWVGNCVGKRNYRYFYLFILSLSLLTIYVFA--------------------FNIV-------YVA 207

  Fly   199 NTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFIS 263
            .....|.||..:..:                ..|...:..|.:.|      .:::|..|..||:.
Human   208 LKSLKIGFLETLKET----------------PGTVLEVLICFFTL------WSVVGLTGFHTFLV 250

  Fly   264 PL 265
            .|
Human   251 AL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 34/130 (26%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 41/164 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.