DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:180 Identity:55/180 - (30%)
Similarity:84/180 - (46%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VHPLSIVFVLCSTAFFFSLQMFYIAPKV---FGDIAYKLYWILV------TFITHNILGNMLAC- 77
            |..|:::.:|.:|..||.....|:|..:   ...||..|::.::      :|....||.....| 
Mouse    85 VFALTLLLILSTTILFFVFDCPYLARTLTLAIPIIAAILFFFVMSCLLQTSFTDPGILPRATICE 149

  Fly    78 --YMTSSSVNTLSKDSRCPNPEDEPLWH-------YCESCKKLRSPRSWHCVLCNTCILRRDHHC 133
              .:.....||.|...|.|....|.:.:       ||.:||..|.||:.||.:|:.|:.|.||||
Mouse   150 AAALEKQIDNTGSSTYRPPPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHC 214

  Fly   134 IFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFC----MFILQNGGNFMS 179
            .:.|.|:|..|.|||  :.|.|:|..:|:|...|    :.:|..|.||:|
Mouse   215 PWVGNCVGRRNYRFF--YAFILSLSFLTAFIFACVVTHLTLLSQGSNFLS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 34/88 (39%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 34/82 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.