DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:242 Identity:51/242 - (21%)
Similarity:91/242 - (37%) Gaps:52/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNT-LSKDSRCPNPEDEPLWH----- 103
            |.|..|.|.:          |:.|.:: :::|..:..:..|. |.||...|.|..:...|     
  Rat    73 YAANAVMGGV----------FMFHLVV-HLIAITIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQ 126

  Fly   104 --YCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGL-----VT 161
              ||..|:...|.::.||..||.|:...||||.:...|:|..|..|||:.......||     :.
  Rat   127 NQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLNNCVGKRNYWFFFFSVASAAFGLLGVLIIL 191

  Fly   162 SFATFCMFILQNG---------------------GNFMSLSS----VIFNLITRTFFQNYTGNTF 201
            .:.....|:..||                     ..|:.:||    ::|..::....:.....:.
  Rat   192 LYIFIQYFVNPNGLRMDPLYKGAAVWIGAGWTCLSVFIEISSENTWLLFLSLSPVPVKTPVVLSI 256

  Fly   202 ETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKN 248
            ..:..||.|::..:...:|.:...::|:.   .:.||......|:|:
  Rat   257 AAMVLLLAIASFVLLGHLLVFHFYLISKK---LSTFDYMMQTRFQKS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 34/167 (20%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.