DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc15a

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001006003.1 Gene:zdhhc15a / 449833 ZFINID:ZDB-GENE-041010-87 Length:328 Species:Danio rerio


Alignment Length:183 Identity:46/183 - (25%)
Similarity:81/183 - (44%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCM 168
            :|..|:.::..|..||.:|.||:|:.||||::...|:|.:|.:||..|..|..|        :|:
Zfish   124 FCHHCQLIKPDRCHHCSVCQTCVLKMDHHCLWLNNCMGFSNYKFFMLFLLYSLL--------YCL 180

  Fly   169 FILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFET-----IAFLLNISASY--MPAFMLAYQMQI 226
            .|:              :.:|.|..|.:.|..|::     :.||..:||.:  ...|:|.:.:.:
Zfish   181 LIV--------------STVTPTVIQLWRGRLFDSCVELHVLFLTLVSAIFAITLCFLLIFHIWL 231

  Fly   227 LSQNSTYYNIFDC----------TYDLGFRKNCQTIMG-QRGLWTFISPLLKS 268
            |:.|.|.......          .:|:|.:.|...:.| ::.||.|  |:..|
Zfish   232 LTSNKTTLEWLSVPFFVNGPGSKAFDVGVQANFLQVFGKKKRLWLF--PVFSS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 37/136 (27%)
zdhhc15aNP_001006003.1 DHHC 123..243 CDD:366691 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.