DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG17198

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster


Alignment Length:263 Identity:100/263 - (38%)
Similarity:153/263 - (58%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNP 96
            :|...||:..:.||:.|:..|.....:::::.|:|.:|||.|:..|..|.::|::|....:.|..
  Fly    45 VCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPMK 109

  Fly    97 EDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVT 161
            .:|.|||:|:.|::...||||||.:|:.|||:|||||.|.|.|:||||||:|.||:||..:|  :
  Fly   110 GEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIG--S 172

  Fly   162 SFATFCMFIL--QNGGNFMSL---SSVIFNLITRTFFQNYTGNTFETIAFL-------LNISASY 214
            :.|.|..|:|  ::|..|..|   :.:|||.     :.| .|.. |.:.|.       :||.|..
  Fly   173 AVALFDNFMLAHKHGVGFFDLVKANYIIFNA-----YMN-PGRK-ELVIFYRIVSVLGVNIFAVL 230

  Fly   215 MPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFISPLLKSPLPHDGAHWQM 279
            .||.:...|:..:.:||..::..|.|||||...|...|:|.|.|||.:||.:||||||:|..|:.
  Fly   231 FPAALFCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWKS 295

  Fly   280 KQS 282
            |::
  Fly   296 KRA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 55/142 (39%)
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 54/132 (41%)
zf-DHHC 111..252 CDD:279823 58/149 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469536
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.