Sequence 1: | NP_651427.2 | Gene: | CG17195 / 43113 | FlyBaseID: | FBgn0039369 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017214210.1 | Gene: | zdhhc16a / 394017 | ZFINID: | ZDB-GENE-040426-1621 | Length: | 395 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 50/206 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQ---------------MFYIAPKVFG----- 52
Fly 53 -------DIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLS------KDSRCP---NPE---D 98
Fly 99 EPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSF 163
Fly 164 ATFCMFILQNG 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17195 | NP_651427.2 | zf-DHHC | 103..234 | CDD:279823 | 30/72 (42%) |
zdhhc16a | XP_017214210.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |