DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc16a

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_017214210.1 Gene:zdhhc16a / 394017 ZFINID:ZDB-GENE-040426-1621 Length:395 Species:Danio rerio


Alignment Length:206 Identity:51/206 - (24%)
Similarity:83/206 - (40%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQ---------------MFYIAPKVFG----- 52
            |.:..:|.|:...|.|..:.::|   .:.:|.||.               |..:..:.||     
Zfish    27 CRHTRSRVPRRLRRHVSYIRLIF---KSLYFNSLTNSDVVTDSILEPVFWMVEVVTRWFGMVFVF 88

  Fly    53 -------DIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLS------KDSRCP---NPE---D 98
                   .:.:..|:.|:..:.|......:..::.....|.:.      |.::.|   .|:   |
Zfish    89 LVVALTSSVVFIAYFCLLPLVLHTYSPGWMIWHICYGHWNLVMIVFHYYKATKTPPGYPPKMKTD 153

  Fly    99 EPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSF 163
            .|....|:.|...:..||.||.:|.||||:.||||.:...|:||.|.|:||.|..:||||     
Zfish   154 VPFVSVCKKCIIPKPARSHHCGICKTCILKMDHHCPWLNNCVGHFNHRYFFSFCLFLTLG----- 213

  Fly   164 ATFCMFILQNG 174
               ||:...:|
Zfish   214 ---CMYCSVSG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 30/72 (42%)
zdhhc16aXP_017214210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.