| Sequence 1: | NP_651427.2 | Gene: | CG17195 / 43113 | FlyBaseID: | FBgn0039369 | Length: | 283 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648561.2 | Gene: | app / 39399 | FlyBaseID: | FBgn0260941 | Length: | 755 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 49/202 - (24%) |
|---|---|---|---|
| Similarity: | 78/202 - (38%) | Gaps: | 60/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 LSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNT---- 86
Fly 87 --------------LSKDSRCPNPEDEPLWH------------------YCESCKKLRSPRSWHC 119
Fly 120 VLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCM---FILQNGGNFMSLS 181
Fly 182 SVIFNLI 188 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17195 | NP_651427.2 | zf-DHHC | 103..234 | CDD:279823 | 33/107 (31%) |
| app | NP_648561.2 | zf-DHHC | 146..270 | CDD:279823 | 33/90 (37%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45467548 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||