DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG4483

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:305 Identity:63/305 - (20%)
Similarity:106/305 - (34%) Gaps:94/305 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIVH--PLSIV-FVLCSTAFFFSLQMFYIAP--KVFGDIAYKLYWILVTFITHNILGNMLACYMT 80
            |.:|  |:::: ..|..|.....:...:.||  .:...:.|.|.||......:|.:.:::.    
  Fly    11 RFIHWGPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMV---- 71

  Fly    81 SSSVNTLSKDSRCPNPEDEPL-WH-----------YCESCKKLRSPRSWHCVLCNTCILRRDHHC 133
                          .|...|| ||           :|..|...::|||.||..||.|:::.||||
  Fly    72 --------------GPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHC 122

  Fly   134 IFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQ---- 194
            .:..||:|.:||..|.:|..:...|.:             .|..:.:|:||..:..|...:    
  Fly   123 PWINTCVGWSNQDSFVYFLLFFMSGSI-------------HGGIIIVSAVIRGIKKRWLIRYGLR 174

  Fly   195 -----NYTGNTFETIAFLLN-ISASYMPAFMLAY-QMQILSQNSTY------------------- 233
                 :.|........|.|. |..:.:.:..|.| ||:.:.:|.|.                   
  Fly   175 HMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRK 239

  Fly   234 -YNIFDCTYDLGFRKNCQTIMGQRGLWTFISPLLKSPLPHDGAHW 277
             ...|...|:||::.|.:.:....|               ||..|
  Fly   240 GIKPFVYPYNLGWKTNMREVFFSTG---------------DGISW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/172 (22%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.