DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG17287

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:204 Identity:53/204 - (25%)
Similarity:88/204 - (43%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165
            |..||::|..::..|:.||..|:.|:|:.||||.:...|:..:|.::|..|.||..   |..|..
  Fly   123 LVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAE---VYCFYL 184

  Fly   166 FCMFIL---------------QNGGNFMS-LSSVIFNLITRTFFQNYTGNTFETIAFLLNIS--- 211
            ||:.:.               |:..|.:. |..::||:.|...:         |:: |||:|   
  Fly   185 FCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMY---------TVS-LLNVSRNR 239

  Fly   212 ----ASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRG-LWTFISPLLKS--- 268
                ::|...|:|.      .:|:..:|       ||:..|.:.:.|.:. ||.|  |:..|   
  Fly   240 TTMESAYATYFLLG------GKNNNGFN-------LGYFVNFRDLYGDKWYLWPF--PIFSSRGD 289

  Fly   269 ----PLPHD 273
                ||.||
  Fly   290 GFSFPLAHD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/153 (25%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467491
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.