DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc13

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001382044.1 Gene:Zdhhc13 / 365252 RGDID:1309736 Length:622 Species:Rattus norvegicus


Alignment Length:299 Identity:76/299 - (25%)
Similarity:111/299 - (37%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KNFVRI--VHPLSIVFVLCSTAF--FF---SLQMFYIAPKVFGDIAYKLYWILVTFITH------ 68
            ||.|.:  |..||.:|.:..|.|  ||   :...||.| .:|..:|: ||:...|:.|.      
  Rat   342 KNLVYLPTVFLLSSIFWIFMTWFILFFPDAAGSPFYFA-FIFSIMAF-LYFFYKTWATDPGFTKA 404

  Fly    69 -------NILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSP-RSWHCVLCNTC 125
                   ||:          :...|.|.|.|.          :|.|| .:|.| ||.||.:||:|
  Rat   405 SEEERKVNIV----------TLAETGSLDFRT----------FCTSC-LIRKPLRSLHCHVCNSC 448

  Fly   126 ILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTL-------GLVTSFATFCMFILQNGGNFMSLSSV 183
            :.|.|.||.:||.|||..|...:.:|...|::       |....::..|....:..|.:..|:.:
  Rat   449 VARFDQHCFWTGRCIGFGNHHHYIFFLLSLSMVCDWIIYGSFVYWSNHCATTFKEDGLWTYLNQI 513

  Fly   184 I---------------------FNLITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAYQMQIL 227
            :                     |.||.:.|...:.|.|......||..|         .:..|.|
  Rat   514 VACSPWVLYIFMLAAFHFSWSTFLLINQLFQIAFLGLTSHERISLLKQS---------RHMKQTL 569

  Fly   228 SQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFISPLL 266
            |...|.||       |||.:|..... |.|.:..:.|.:
  Rat   570 SLRKTPYN-------LGFMQNLADFF-QCGCFGLVKPCI 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 41/159 (26%)
Zdhhc13NP_001382044.1 Ank_2 66..>269 CDD:423045
ANK repeat 81..112 CDD:293786
ANK repeat 114..146 CDD:293786
ANK repeat 148..179 CDD:293786
ANK repeat 181..247 CDD:293786
DHHC 423..557 CDD:396215 36/144 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.