DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG4676

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:139/274 - (50%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VHPLSI----------VFVLCSTAFFFSLQMFYIAPKVF--GDIAYKLYWILVTFITHNILGNML 75
            |.|.||          |||..:..|..::.|    |::|  |.|.|.|.|:...|:..||..|||
  Fly    10 VKPRSISDFACFLLVAVFVPVTYIFHVTIVM----PELFAIGGIWYTLLWLASLFLIFNITSNML 70

  Fly    76 ACYMTSSSVNTLSKDSRCPNPEDEPL--WHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGT 138
            ||.:..:|:.   |:...|..:...|  ||.|:.|:.|..||||||.:||.|:|:|||||.||..
  Fly    71 ACMLVDTSIR---KELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCC 132

  Fly   139 CIGHNNQRFFFWFTFYLTLGLVTSFATFCMFI----LQNGGNFMSLSSVIFNLITRTFFQNYTGN 199
            ||||:|.|:||::..|:.:|.:.:.....:::    |.....:.:|.::...:::.....::  .
  Fly   133 CIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSW--E 195

  Fly   200 TFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFISP 264
            :|..:.:.|.:....:.:.:|.:...|....|.........||.|.|.|.:.::|:|...|::||
  Fly   196 SFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSP 260

  Fly   265 LLKSPLPHDGAHWQ 278
            .|:|.|||||.:|:
  Fly   261 FLRSDLPHDGMNWE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/134 (28%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 37/134 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469550
Domainoid 1 1.000 42 1.000 Domainoid score I12426
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.900

Return to query results.
Submit another query.