DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001034427.1 Gene:Zdhhc5 / 362156 RGDID:1589737 Length:715 Species:Rattus norvegicus


Alignment Length:176 Identity:47/176 - (26%)
Similarity:79/176 - (44%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKNFVRIVHPLS--IVFVLCSTAFFFSLQMFYIAPKVFGDI--AYKLY-WILVTFITHNILGNML 75
            |..:|    |:|  .:|::.:|..||:    :..|.:..|:  |..:| .|:..|:..|.   .:
  Rat    11 PSKYV----PVSAAAIFLVGATTLFFA----FTCPGLSLDVSPAVPIYNAIMFLFVLANF---SM 64

  Fly    76 ACYMTSSSVNTLSKDSRCPNPEDE---PLW------------HYCESCKKLRSPRSWHCVLCNTC 125
            |.:|.........:|.   :.||:   ||:            .:|.:|:..|.||..||.:|:.|
  Rat    65 ATFMDPGIFPRAEEDE---DKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNC 126

  Fly   126 ILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFIL 171
            :...||||.:...|||..|.|:||.|...||..::..|....:::|
  Rat   127 VEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 25/69 (36%)
Zdhhc5NP_001034427.1 zf-DHHC 99..224 CDD:279823 25/74 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.