DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:325 Identity:70/325 - (21%)
Similarity:118/325 - (36%) Gaps:94/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNRFCHYFANRYPKNFVRIVHPLSI--VFVLCST-AFFFSLQMFYIAPKVFGDIAYKLYWILVTF 65
            :.|.||:             .|:..  |..:||| |...|:..::......|.:.:.:.......
  Rat    16 LRRLCHW-------------GPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVM 67

  Fly    66 ITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRD 130
            |.:|....|.|      ....:.:..:..||:|.....||:.|:..::|||.||..||.|:::.|
  Rat    68 ILYNYFNAMFA------GPGFVPRGWKPENPQDSMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMD 126

  Fly   131 HHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQN 195
            |||.:...|.||.|...|..|.....||     .|...||.     .|::.:.::|.:      :
  Rat   127 HHCPWINNCCGHQNHASFTLFLLLAPLG-----CTHAAFIF-----VMTMYTQLYNRL------S 175

  Fly   196 YTGNT----------------------FETIAFLLNISASYMPAFMLAY--QMQILSQNST---- 232
            :..||                      |....|.|.::.....|..:.:  |::|:.:|.|    
  Rat   176 FGWNTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIKIILRNKTSIES 240

  Fly   233 -----------YY---NIFDCTYDLGFR-KNCQTIMGQRGLWTFISPLLKSPLPH-DGAHWQMKQ 281
                       ||   .:|...||:|.: ||.:.:.    .|        |.:|. ||..|.:::
  Rat   241 WIEEKAKDRIQYYQLDEVFVFPYDMGSKWKNLKQVF----TW--------SGVPEGDGLEWPIRE 293

  Fly   282  281
              Rat   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/169 (22%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 38/161 (24%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.