DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG2611

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster


Alignment Length:150 Identity:27/150 - (18%)
Similarity:49/150 - (32%) Gaps:56/150 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYK-LYWILVTFITHNILGNMLACYMTSSSVNTLSK 89
            :.:|...|.|..|.:.|  :..|.:.|.:.:| :..||:.||.    |.:...:.|.:.|...|:
  Fly    28 IKVVESQCETDGFVNEQ--WTEPAMPGPVPWKTIIIILLLFIG----GIVCIAFATLNWVTDTSR 86

  Fly    90 DSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFY 154
            :                     ||.|.|                     .:|......|...::|
  Fly    87 E---------------------RSDRVW---------------------ALGIIGALTFIPGSYY 109

  Fly   155 LTLGLVTSFATFCMFILQNG 174
            :       :..||:.:.:||
  Fly   110 V-------YVLFCIMLNRNG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 10/71 (14%)
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 7/57 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.