| Sequence 1: | NP_651427.2 | Gene: | CG17195 / 43113 | FlyBaseID: | FBgn0039369 | Length: | 283 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_840089.2 | Gene: | zdhhc8b / 352941 | ZFINID: | ZDB-GENE-030407-3 | Length: | 751 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 49/202 - (24%) |
|---|---|---|---|
| Similarity: | 81/202 - (40%) | Gaps: | 25/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 PKNFVRIVHPLSIVFVLC--STAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACY 78
Fly 79 MTSSSVNTLSKDSRCPNPEDEPLW------------HYCESCKKLRSPRSWHCVLCNTCILRRDH 131
Fly 132 HCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLS---SVIFNLITRTFF 193
Fly 194 QNYTGNT 200 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17195 | NP_651427.2 | zf-DHHC | 103..234 | CDD:279823 | 32/101 (32%) |
| zdhhc8b | NP_840089.2 | zf-DHHC | 99..224 | CDD:279823 | 32/106 (30%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 293..346 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 437..461 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 633..659 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 666..685 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 703..736 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||