DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Patsas

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:257 Identity:60/257 - (23%)
Similarity:94/257 - (36%) Gaps:74/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLS---KDSRCP---- 94
            |.||:.::          .|.:|.|....||.|||.....|::..::|..:|   .:.|.|    
  Fly   371 FLFSVLLW----------GYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIP 425

  Fly    95 -------------------NPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCI 140
                               ...:..|...|.||:.||..|:.||.:||.|:...||||.|...|:
  Fly   426 LSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCV 490

  Fly   141 GHNNQRFFFWFTFYLTLGLVTSFATF--CMFILQNG------------------GNFMSLSSVI- 184
            |..|:.:|  |.|.|::.:..||..:  |..::..|                  |..::.:|:: 
  Fly   491 GLRNRMWF--FLFVLSVAVNCSFTIYFACYCVMIEGFTMLYVLGLIEAVVFCGLGWILTCTSILH 553

  Fly   185 --FNLITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLG 244
              .||.|...| ||     :...:|.:....|...|.....:.:|       ..|.|..|.|
  Fly   554 ACMNLTTNEMF-NY-----KRYPYLRDKRGRYQNPFSRGPILNLL-------EFFVCLPDRG 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/153 (25%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 35/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.