DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and pfa5

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:323 Identity:77/323 - (23%)
Similarity:123/323 - (38%) Gaps:101/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KNFVRIVHPLSIVF---VLCSTAF----FFSL-----------------------QMFYIAPKVF 51
            :.|.::...|.:||   :|.||.:    |.:|                       ..|:|.    
pombe    10 RRFSKLQKTLGVVFPAAILLSTGYTVWVFIALICVDSNIKIRNGYRNLGGGIVLIIFFFIT---- 70

  Fly    52 GDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRS 116
            ..:||..|: .|.|.:.:..||.|..|....:...|     | .|...|  ..|.:||.....||
pombe    71 SGLAYFSYF-RVLFSSPSFCGNTLYTYYGFDNPIFL-----C-GPNGAP--RMCGTCKCWLPDRS 126

  Fly   117 WHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLS 181
            .|..:...||.:.||:|.|.|..:..:||:||:.|.||       .|:..||.:         :|
pombe   127 HHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFY-------GFSAACMVL---------IS 175

  Fly   182 SVIFNLITRTF-FQNYTGNTFETIAF-------------------LLNISA-----------SYM 215
            :.|  :|:||: :::..|.....:.|                   ||||::           |:.
pombe   176 TAI--MISRTYHYRSLPGTWIFVLVFSAFGVLFLGVMLVRHTGYLLLNINSHEAKNWKTRIYSFS 238

  Fly   216 PAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLW-TFISPLLKSPLPHDGAHW 277
            ..|......::|.|:..    .|..:|.|:.:|.:.:||..  | .:|.||.:|  |.||.|:
pombe   239 VFFPEHMDSRVLVQSDP----GDLPWDRGYSENWRAVMGDH--WYNWILPLRRS--PGDGEHF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/161 (24%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 70/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.