Sequence 1: | NP_651427.2 | Gene: | CG17195 / 43113 | FlyBaseID: | FBgn0039369 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007461.1 | Gene: | Zdhhc23 / 332175 | MGIID: | 2685625 | Length: | 425 | Species: | Mus musculus |
Alignment Length: | 299 | Identity: | 63/299 - (21%) |
---|---|---|---|
Similarity: | 105/299 - (35%) | Gaps: | 110/299 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 TAFFFSLQMFYIAPKVFGDIAYKLYWIL-------------VTFITHNILGNMLACYMTSSSVNT 86
Fly 87 LSKDS-------RCPNPE----------------------------------DEPL-----WHYC 105
Fly 106 ESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFI 170
Fly 171 LQNGGNFMSLSSVI--FNLITRTF-----FQNYTGN-TFETIAFLLNISASYMPAFMLAYQMQIL 227
Fly 228 SQNSTYYNIFDC------------------TYDLGFRKN 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17195 | NP_651427.2 | zf-DHHC | 103..234 | CDD:279823 | 37/138 (27%) |
Zdhhc23 | NP_001007461.1 | DHHC | 248..374 | CDD:396215 | 38/142 (27%) |
Interaction with NOS1. /evidence=ECO:0000250 | 422..425 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |