DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:299 Identity:63/299 - (21%)
Similarity:105/299 - (35%) Gaps:110/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TAFFFSLQMFYIAPKVFGDIAYKLYWIL-------------VTFITHNILGNMLACYMTSSSVNT 86
            |.||.||.:|        .:.|..|..|             :..:|..:|..:||.|....:...
Mouse   132 TLFFLSLGLF--------SLGYMYYVFLREVVPQGRVGPTQLALLTCGLLLILLALYRAKKNPGY 188

  Fly    87 LSKDS-------RCPNPE----------------------------------DEPL-----WHYC 105
            ||.|.       .||..:                                  |.|.     |  |
Mouse   189 LSNDKSPSNSQIECPVKKGQEKTKGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAKVKEDW--C 251

  Fly   106 ESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFI 170
            ..|:.:|..|:|||.:|..|:.|.||||::..:|:|.:|.:.|.   ..|::.|:||..      
Mouse   252 AKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFI---LALSIFLLTSVY------ 307

  Fly   171 LQNGGNFMSLSSVI--FNLITRTF-----FQNYTGN-TFETIAFLLNISASYMPAFMLAYQMQIL 227
                |..::|:::.  .:|.|..|     :.||:.. :|..:.:.:.|:|..  |::...|:..:
Mouse   308 ----GISLTLNTICRDRSLFTALFYCPGVYANYSSALSFTCVWYSVIITAGM--AYIFLIQLINI 366

  Fly   228 SQNSTYYNIFDC------------------TYDLGFRKN 248
            |.|.|...:...                  .|:.||.:|
Mouse   367 SYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 37/138 (27%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 38/142 (27%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.