DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and CG17075

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:273 Identity:55/273 - (20%)
Similarity:106/273 - (38%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYVNRFCHYFAN----RYPKNFVRIVHPLSIVFVLCSTAFFFSLQMF-YIAPKVFGDIAYKLYW 60
            :|.:::...|.:|    ::.|.  |.:|.|.:.        ...||:| ::...:||..:   ||
  Fly    79 LCRLSQLVSYQSNIADVQHRKG--RRLHGLQLP--------LHPLQIFGWLVLLLFGVAS---YW 130

  Fly    61 ILVTFITHNILGNM-----------LACYMTSSSVNTLSKDSRCPNPEDEPLWHY---------- 104
            :|:......|.|.:           :|.::|:...:...|:.|..:..|..:..:          
  Fly   131 VLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHVIE 195

  Fly   105 ---CESCK-KLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165
               |..|. :..|.|:.||.:||.|:.:.||||.:...|||..|   :..|...:...:|.:...
  Fly   196 NGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRN---YVAFLMCVVSAVVATLVI 257

  Fly   166 FCMFILQNGGNFMSLSSVIFNLITRTFFQNY-----TGNTFETIAFLLNISASYMPAFMLAYQMQ 225
            ....:.|          ::|..|...:...|     :.:|.|:..| :||:.|.....|:..: |
  Fly   258 VAAVVAQ----------IVFYYIQPDWLSFYWCPTESSHTIESGDF-INITLSLSNGTMMLIE-Q 310

  Fly   226 ILSQNSTYYNIFD 238
            ..|:...:..::|
  Fly   311 HTSEEDVHQEMWD 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 32/149 (21%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.