DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:245 Identity:53/245 - (21%)
Similarity:86/245 - (35%) Gaps:89/245 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEP----------------- 100
            |.||.        |.:.|:.|:||....:|....:..|     |...|                 
  Rat    72 DYAYS--------IINGIVFNLLAFLALASHCRAMLTD-----PGAVPKGNATKEFIESLQLKPG 123

  Fly   101 -LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFA 164
             :.:.|..|..::..|:.||.:|..||.:.||||.:...|:|.|||::|..||.|:.|       
  Rat   124 QVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIAL------- 181

  Fly   165 TFCMFILQNGGNFMSLSSVI---FNLITRTFFQNYTGNT---------------FETIAFLLNIS 211
                         :||.::|   |:.: ..|.:::|..:               ||.:.||:..|
  Rat   182 -------------ISLHALIMVGFHFL-HCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTS 232

  Fly   212 ASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRK--NCQTIMGQRGLW 259
            .      |...|:..:           ||.:.|..:  ..:....|.|.|
  Rat   233 V------MFGTQVHSI-----------CTDETGIERLQRSKQPREQSGSW 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/148 (24%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.