DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:293 Identity:75/293 - (25%)
Similarity:109/293 - (37%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFS---LQMFYI-----APKVFGDIAYKLYWILVTFITHNILGNMLACYMTSS 82
            :.:||    ||.:.:   |::.|:     .|.....:|..|...|..:...|:||||.....:..
  Rat    17 MPVVF----TALWAAVVVLELTYVMVLGPGPPPLEPLARALQLALAAYQLLNLLGNMGLFLRSDP 77

  Fly    83 SVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRF 147
            |:..:....|.....    |.||..|:....|||.||..|..|||||||||...|.|:|.:|.|.
  Rat    78 SIRGVMLAGRGLGQG----WAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFHNYRP 138

  Fly   148 FFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFETIAFLLNISA 212
            |                 .|: :|...|..:.: ||:.:.......|.:  :...|:|.||    
  Rat   139 F-----------------LCL-LLHAAGVLLHI-SVLLSPALSALLQAH--SALYTVALLL---- 178

  Fly   213 SYMPAFMLAYQMQILSQNSTYYNIFDC--------------------------------TYDLGF 245
              :|..||......|:|.:..:.:..|                                :||||.
  Rat   179 --LPWLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLGM 241

  Fly   246 RKNCQTIMGQRGLWTFISPLLKSPLPHDGAHWQ 278
            ..|.|..:|.|....:..|.|.||||.||..:|
  Rat   242 SHNLQAALGPRWALVWFWPFLASPLPGDGITFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 39/130 (30%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4710
OMA 1 1.010 - - QHG47998
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm44609
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.