DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:223 Identity:55/223 - (24%)
Similarity:78/223 - (34%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHN-----------ILGNMLAC 77
            |||.||..|        |.:|:   .|.|      :.:||..:.|:           |....|..
  Rat    46 HPLQIVAWL--------LYLFF---AVIG------FGVLVPLLPHHWVPAGYACMGAIFAGHLVV 93

  Fly    78 YMTSSSV-----NTLSKDSRCPNPEDEPLWH-------YCESCKKLRSPRSWHCVLCNTCILRRD 130
            ::|:.|:     |...|....|.|......|       :|..|....|.||.||..||.|:...|
  Rat    94 HLTAVSIDPADANVRDKSYSGPLPIFNRSQHAHVIEDLHCNLCDVDVSARSKHCSACNKCVCGFD 158

  Fly   131 HHCIFTGTCIGHNNQRFFFWFTFYLTLG--LVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFF 193
            |||.:...|:|..|.|.|........||  |:...||: :|:                    .||
  Rat   159 HHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATY-VFV--------------------EFF 202

  Fly   194 QN----YTGNTFETIAFLLNISASYMPA 217
            .|    .|...||.:....::...::||
  Rat   203 VNPMRLRTNQHFEVLKNHTDVWFVFLPA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 34/128 (27%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.