DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:284 Identity:68/284 - (23%)
Similarity:100/284 - (35%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSIVFVLCSTAFFFSLQMF------------------YIAPKVFGDIAYKLYWILVTFITHNIL 71
            |||..|.....||..||.:|                  ::.|.|.|.:....::.||:       
  Rat    24 PLSWFFPSLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPAVTGPLFILTFFSLVS------- 81

  Fly    72 GNMLACYMTSSSVNTLSKDSRCPNPEDEPL---------WHYCESCKKLRSPRSWHCVLCNTCIL 127
                   :..|....|.:.|...:|....:         ..:|..|...|.||::||..||.|:.
  Rat    82 -------LNFSDPGILHRGSVSEDPRTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVE 139

  Fly   128 RRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTF 192
            ..||||.:...||||.|.|.|.....:|.|.......|..||::..       |.:.|:|     
  Rat   140 DFDHHCKWVNNCIGHRNFRLFVLLILFLCLYSGALLVTCLMFLIHT-------SHLPFSL----- 192

  Fly   193 FQNYTGNTFETIAFLLNISAS--YMPAFMLAYQMQILS------------QNSTYYNIFDCTYDL 243
                    .:.:|.|:.:.|:  .:|.|:|.. :|.||            ::...||.|    |.
  Rat   193 --------DKAMAILVAVPAAGFLIPLFLLML-IQALSVSRAERSYESKCRDHEEYNPF----DQ 244

  Fly   244 GFRKNCQTIMGQRGLW--TFISPL 265
            ||.||          |  |..:||
  Rat   245 GFAKN----------WYLTMCAPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/144 (26%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.