DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC22

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001351101.1 Gene:ZDHHC22 / 283576 HGNCID:20106 Length:263 Species:Homo sapiens


Alignment Length:279 Identity:65/279 - (23%)
Similarity:112/279 - (40%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRIVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYK-------LYWILVTFITHNILGNML-- 75
            :|:::.::..:.||.:...|.||:|...|.:..|.|..       |:..|..|::.|.|||.:  
Human     4 LRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSANALGNYVLV 68

  Fly    76 ---------ACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDH 131
                     ||...|      ::.:.||:|..    |:|..|.::              .||.||
Human    69 IQNSPDDLGACQGAS------ARKTPCPSPST----HFCRVCARV--------------TLRHDH 109

  Fly   132 HCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMS-LSSVIF-------NLI 188
            ||.|||.|||..|.|.|..|..|.:|.        |::.:..|..::| :.|:.|       .|:
Human   110 HCFFTGNCIGSRNMRNFVLFCLYTSLA--------CLYSMVAGVAYISAVLSISFAHPLAFLTLL 166

  Fly   189 TRTFFQNYTG-----NTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFD--CTYDLGFR 246
            ..:..|.::|     ..|..:...|..:.....|....:|:.::.:..|.:.:..  ......:|
Human   167 PTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVAVRARPWR 231

  Fly   247 KNCQTIMGQRGLWTFISPL 265
            ||.|.:.|:|.|...:.|:
Human   232 KNLQEVFGKRWLLGLLVPM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 34/143 (24%)
ZDHHC22NP_001351101.1 DHHC 92..218 CDD:366691 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.