DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC5

DIOPT Version :10

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_056272.2 Gene:ZDHHC5 / 25921 HGNCID:18472 Length:715 Species:Homo sapiens


Alignment Length:178 Identity:47/178 - (26%)
Similarity:78/178 - (43%) Gaps:38/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKNFVRIVHPLS--IVFVLCSTAFFFSLQ----MFYIAPKVFGDIAYKLY-WILVTFITHNILGN 73
            |..:|    |:|  .:|::.:|..||:..    ..|::|      |..:| .|:..|:..|.   
Human    11 PSKYV----PVSAAAIFLVGATTLFFAFTCPGLSLYVSP------AVPIYNAIMFLFVLANF--- 62

  Fly    74 MLACYMTSSSVNTLSKDSRCPNPEDE---PLW------------HYCESCKKLRSPRSWHCVLCN 123
            .:|.:|.........:|.   :.||:   ||:            .:|.:|:..|.||..||.:|:
Human    63 SMATFMDPGIFPRAEEDE---DKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCD 124

  Fly   124 TCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFIL 171
            .|:...||||.:...|||..|.|:||.|...||..::..|....:::|
Human   125 NCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 DHHC 103..234 CDD:396215 25/69 (36%)
ZDHHC5NP_056272.2 DHHC 99..224 CDD:396215 25/74 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.