DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:284 Identity:76/284 - (26%)
Similarity:111/284 - (39%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSIVFVLCST-AFFFSLQMFYI-----APKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSS 83
            |..:..||.:. |....|::.|:     .|...|.:|..|...|..|...|:|||:.....:..|
Human    14 PAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPS 78

  Fly    84 VNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFF 148
            :..:....|.....    |.||..|:....|||.||..|..|||||||||...|.|:|..|.|.|
Human    79 IRGVMLAGRGLGQG----WAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPF 139

  Fly   149 FWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVI----------------FNLITRTFFQNYT 197
                             .|: :|...|..:.:|.::                ..|:...:....|
Human   140 -----------------LCL-LLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLT 186

  Fly   198 GNT----FETIAFLLN---ISASYMPAFMLAYQMQILSQNSTY-YNIFDCTYDLGFRKNCQTIMG 254
            |..    | .:||:.:   ..|....|.:|.:.|.:|...:|: :.....:||||...|.|..:|
Human   187 GRVSLAQF-ALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALG 250

  Fly   255 QRGLWTFISPLLKSPLPHDGAHWQ 278
            .|....::.|.|.||||.||..:|
Human   251 PRWALVWLWPFLASPLPGDGITFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 40/154 (26%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12426
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm40467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.