DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:302 Identity:61/302 - (20%)
Similarity:118/302 - (39%) Gaps:95/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFSLQMFYIAPKVFGD----------IAYKLYWILVTFITHNILGNMLACYMT 80
            |.|.||:..:.:.:.:::....  :||:          :|:.|::::..:          :.:||
Human    20 LFITFVVVWSYYAYVVELCVFT--IFGNEENGKTVVYLVAFHLFFVMFVW----------SYWMT 72

  Fly    81 -SSSVNTLSKDSRCPNPEDE----------------------PLW--------HYCESCKKLRSP 114
             .:|..:.||:....|.|.|                      |::        .|||.|:.::..
Human    73 IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPD 137

  Fly   115 RSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMS 179
            |:.||..|::|||:.||||.:...|:|.:|.:||..|..|..|        :|:|:...      
Human   138 RAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLL--------YCLFVAAT------ 188

  Fly   180 LSSVIFNLITRTFFQNYTGNTFET-----IAFLLNISASYMPAF--MLAYQMQILSQNSTYYNIF 237
                    :...|.:.:|....:|     :.||..:||.:..:.  :.:|...::.:|.|....|
Human   189 --------VLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESF 245

  Fly   238 DCT----------YDLGFRKNCQTIMG-QRGLWTFISPLLKS 268
            ...          :.||..||.:.:.| ::..|  :.|:..|
Human   246 RAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYW--LLPIFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/137 (26%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 61/302 (20%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.