DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc5

DIOPT Version :10

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:176 Identity:46/176 - (26%)
Similarity:79/176 - (44%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKNFVRIVHPLS--IVFVLCSTAFFFSLQMFYIAPKVFGDI--AYKLY-WILVTFITHNILGNML 75
            |..:|    |:|  .:|::.:|..||:    :..|.:..::  |..:| .|:..|:..|.   .:
Mouse    11 PSKYV----PVSAAAIFLVGATTLFFA----FTCPGLSLNVSPAVPIYNAIMFLFVLANF---SM 64

  Fly    76 ACYMTSSSVNTLSKDSRCPNPEDE---PLW------------HYCESCKKLRSPRSWHCVLCNTC 125
            |.:|.........:|.   :.||:   ||:            .:|.:|:..|.||..||.:|:.|
Mouse    65 ATFMDPGIFPRAEEDE---DKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNC 126

  Fly   126 ILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFIL 171
            :...||||.:...|||..|.|:||.|...||..::..|....:::|
Mouse   127 VEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 DHHC 103..234 CDD:396215 25/69 (36%)
Zdhhc5NP_659136.1 DHHC 99..224 CDD:396215 25/74 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.