DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:312 Identity:68/312 - (21%)
Similarity:115/312 - (36%) Gaps:97/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLACYMTSSSV------ 84
            |:::.:|.::..||:....|:|.|:...|.. :..||..|    ::|.:|....:...|      
Mouse    66 LTLILILVTSGLFFAFDCRYLAEKITPAIPV-VGGILFFF----VMGTLLRTSFSDPGVLPRATP 125

  Fly    85 -------------NTLSKDSRCPNPEDEPL--------WHYCESCKKLRSPRSWHCVLCNTCILR 128
                         |..|.....|.|..:.:        ..||.:||..|.||:.||.||:.|:.:
Mouse   126 DEAADLERQIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQ 190

  Fly   129 RDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFF 193
            .||||.:.|.|:|..|.|||:.|...|      ||.|..:|           :.||.::|.|:..
Mouse   191 FDHHCPWVGNCVGKRNYRFFYMFILSL------SFLTVFIF-----------AFVITHVIHRSQQ 238

  Fly   194 QNYTGNTFETIAFLLNISASYMPAFML----AYQMQILSQNST---------------------- 232
            :.:.....::.|.:|.....:...:.:    .:...::|.|.|                      
Mouse   239 KGFLDALKDSPASVLEAVICFFSVWSIIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYNPYS 303

  Fly   233 YYNIFDCTYDLGFRKNC---------QTIMGQRGLWTFISPLLKSP-LPHDG 274
            |.|||         .||         .:::.:||   ::.|....| .|.:|
Mouse   304 YGNIF---------TNCCVALCGPISPSLIDRRG---YVQPDTPQPAAPSNG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/156 (24%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 38/141 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.